PDB entry 1a4b

View 1a4b on RCSB PDB site
Description: azurin mutant with met 121 replaced by his, ph 6.5 crystal form, data collected at-180 degrees celsius
Deposited on 1998-01-28, released 1998-04-29
The last revision prior to the SCOP 1.55 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.2015
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1a4ba_
  • Chain 'B':
    Domains in SCOP 1.55: d1a4bb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4bA (A:)
    aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
    tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
    hkgtlklsn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4bB (B:)
    aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
    tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
    hkgtlklsn