PDB entry 1a4b

View 1a4b on RCSB PDB site
Description: azurin mutant with met 121 replaced by his, ph 6.5 crystal form, data collected at-180 degrees celsius
Class: electron transport
Keywords: electron transport, cuproprotein
Deposited on 1998-01-28, released 1998-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Azurin
  Species: Achromobacter denitrificans [TaxId:32002]
  Gene: AZU
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00280 (0-128)
    • conflict (15)
    • see remark 999 (41)
    • conflict (56)
    • engineered (120)
  Domains in SCOPe 2.08: d1a4ba_
• Chain 'B':
  Compound: Azurin
  Species: Achromobacter denitrificans [TaxId:32002]
  Gene: AZU
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00280 (0-128)
    • conflict (15)
    • see remark 999 (41)
    • conflict (56)
    • engineered (120)
  Domains in SCOPe 2.08: d1a4bb_
• Heterogens: CU, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a4bA (A:)
  aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
  tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
  hkgtlklsn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a4bB (B:)
  aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
  tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
  hkgtlklsn