PDB entry 1a49

View 1a49 on RCSB PDB site
Description: bis mg-ATP-k-oxalate complex of pyruvate kinase
Class: transferase
Keywords: transferase, pyruvate kinase, rabbit muscle, domain movement, potassium binding
Deposited on 1998-02-12, released 1999-04-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.198
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1a49a1, d1a49a2, d1a49a3
  • Chain 'B':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1a49b1, d1a49b2, d1a49b3
  • Chain 'C':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1a49c1, d1a49c2, d1a49c3
  • Chain 'D':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1a49d1, d1a49d2, d1a49d3
  • Chain 'E':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1a49e1, d1a49e2, d1a49e3
  • Chain 'F':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1a49f1, d1a49f2, d1a49f3
  • Chain 'G':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1a49g1, d1a49g2, d1a49g3
  • Chain 'H':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1a49h1, d1a49h2, d1a49h3
  • Heterogens: K, OXL, MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a49A (A:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a49A (A:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a49B (B:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a49B (B:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1a49C (C:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a49C (C:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1a49D (D:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a49D (D:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1a49E (E:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a49E (E:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1a49F (F:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a49F (F:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1a49G (G:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a49G (G:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1a49H (H:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a49H (H:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp