PDB entry 1a48

View 1a48 on RCSB PDB site
Description: saicar synthase
Deposited on 1998-02-12, released 1999-03-30
The last revision prior to the SCOP 1.69 freeze date was dated 1999-03-30, with a file datestamp of 1999-03-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.153
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1a48__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1a48_ (-)
    sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
    efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
    rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkaeqgehdenispaqaae
    lvgedlsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdss
    rfwngasykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltg
    skwsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a48_ (-)
    sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
    efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
    rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstdenispaqaaelvgedls
    rrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdssrfwngas
    ykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltgskwsh