PDB entry 1a47

View 1a47 on RCSB PDB site
Description: cgtase from thermoanaerobacterium thermosulfurigenes em1 in complex with a maltohexaose inhibitor
Class: glycosidase
Keywords: glycosidase, thermostable, family 13 glycosyl hydrolase, ligand, substrate, acarbose
Deposited on 1998-02-11, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclodextrin glycosyltransferase
    Species: Thermoanaerobacterium thermosulfurigenes [TaxId:33950]
    Gene: AMYA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a47a1, d1a47a2, d1a47a3, d1a47a4
  • Heterogens: GLC, G6D, ADH, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a47A (A:)
    asdtavsnvvnystdviyqivtdrfvdgntsnnptgdlydpthtslkkyfggdwqgiink
    indgyltgmgvtaiwisqpveniyavlpdstfggstsyhgywardfkrtnpyfgsftdfq
    nlintahahnikviidfapnhtspasetdptyaengrlydngtllggytndtngyfhhyg
    gtdfssyedgiyrnlfdladlnqqnstidsylksaikvwldmgidgirldavkhmpfgwq
    knfmdsilsyrpvftfgewflgtneidvnntyfanesgmslldfrfsqkvrqvfrdntdt
    mygldsmiqstasdynfindmvtfidnhdmdrfynggstrpveqalaftltsrgvpaiyy
    gteqymtgngdpynrammtsfntsttaynvikklaplrksnpaiaygttqqrwinndvyi
    yerkfgnnvalvainrnlstsynitglytalpagtytdvlggllngnsisvasdgsvtpf
    tlsagevavwqyvsssnsplighvgptmtkagqtitidgrgfgttsgqvlfgstagtivs
    wddtevkvkvpsvtpgkynislktssgatsntynniniltgnqicvrfvvnnastvygen
    vyltgnvaelgnwdtskaigpmfnqvvyqyptwyydvsvpagttiqfkfikkngntitwe
    ggsnhtytvpssstgtvivnwqq