PDB entry 1a45

View 1a45 on RCSB PDB site
Description: gammaf crystallin from bovine lens
Class: eye lens protein
Keywords: eye lens protein
Deposited on 1998-02-10, released 1998-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.186
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gammaf crystallin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a45a1, d1a45a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a45A (A:)
gkitfyedrgfqgrhyecssdhsnlqpyfsrcnsirvdsgcwmlyeqpnfqgpqyflrrg
dypdyqqwmglndsirscrliphtgshrlriyeredyrgqmveitedcsslhdrfhfsei
hsfnvlegwwvlyemtnyrgrqyllrpgdyrryhdwgatnarvgslrravdfy