PDB entry 1a41

View 1a41 on RCSB PDB site
Description: type 1-topoisomerase catalytic fragment from vaccinia virus
Class: isomerase
Keywords: type 1b topoisomerase, isomerase
Deposited on 1998-02-10, released 1999-06-01
The last revision prior to the SCOP 1.75 freeze date was dated 1999-06-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.227
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: topoisomerase I
    Species: Vaccinia virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1a41a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a41A (A:)
    nakrdrifvrvynvmkrincfinknikksstdsnyqlavfmlmetmffirfgkmkylken
    etvglltlknkhieispdeivikfvgkdkvshefvvhksnrlykpllkltddsspeeflf
    nklserkvyecikqfgirikdlrtygvnytflynfwtnvksisplpspkklialtikqta
    evvghtpsiskraymattilemvkdknfldvvskttfdeflsivvdhvksstdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a41A (A:)
    nakrdrifvrvynvmkrincfinknikksstdsnyqlavfmlmetmffkenetvglltlk
    nkhieispdeivikfvgkdkvshefvvhksnrlykpllkltddsspeeflfnklserkvy
    ecikqfgirikdlrtygvnytflynfwtnvksisplpspkklialtikqtaevvghtpsi
    skraymattilemvkdknfldvvskttfdeflsivvdhvks