PDB entry 1a41

View 1a41 on RCSB PDB site
Description: type 1-topoisomerase catalytic fragment from vaccinia virus
Deposited on 1998-02-10, released 1999-06-01
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-01, with a file datestamp of 1999-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.227
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1a41__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1a41_ (-)
    nakrdrifvrvynvmkrincfinknikksstdsnyqlavfmlmetmffirfgkmkylken
    etvglltlknkhieispdeivikfvgkdkvshefvvhksnrlykpllkltddsspeeflf
    nklserkvyecikqfgirikdlrtygvnytflynfwtnvksisplpspkklialtikqta
    evvghtpsiskraymattilemvkdknfldvvskttfdeflsivvdhvks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a41_ (-)
    nakrdrifvrvynvmkrincfinknikksstdsnyqlavfmlmetmffkenetvglltlk
    nkhieispdeivikfvgkdkvshefvvhksnrlykpllkltddsspeeflfnklserkvy
    ecikqfgirikdlrtygvnytflynfwtnvksisplpspkklialtikqtaevvghtpsi
    skraymattilemvkdknfldvvskttfdeflsivvdhvks