PDB entry 1a40

View 1a40 on RCSB PDB site
Description: phosphate-binding protein with ala 197 replaced with trp
Class: phosphate-binding protein
Keywords: phosphate-binding protein, mutagenesis, charge complementary, kinetics
Deposited on 1998-02-10, released 1999-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.203
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphate-binding periplasmic protein precursor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06128 (0-320)
      • engineered (196)
    Domains in SCOPe 2.07: d1a40a_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a40A (A:)
    easltgagatfpapvyakwadtyqketgnkvnyqgigssggvkqiiantvdfgasdapls
    deklaqeglfqfptviggvvlavnipglksgelvldgktlgdiylgkikkwddeaiakln
    pglklpsqniavvrradgsgtsfvftsylakvneewknnvgtgstvkwpiglggkgndgi
    aafvqrlpgaigyveywyakqnnlaytklisadgkpvspteenfanaakgadwsktfaqd
    ltnqkgedawpitsttfilihkdqkkpeqgtevlkffdwayktgakqandldyaslpdsv
    veqvraawktnikdssgkply