PDB entry 1a3z

View 1a3z on RCSB PDB site
Description: reduced rusticyanin at 1.9 angstroms
Class: electron transport
Keywords: cupredoxin, metalloprotein, redox potential, acidophilic, electron transport
Deposited on 1998-01-27, released 1998-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rusticyanin
    Species: Acidithiobacillus ferrooxidans [TaxId:920]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24930 (Start-154)
      • conflict (22)
      • conflict (152)
    Domains in SCOPe 2.07: d1a3za_
  • Heterogens: CU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a3zA (A:)
    gtldstwkeatlpqvkamlekddgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkk
    nptleipagatvdvtfintnkgfghsfditkkgppyavmpvidpivagtgfspvpkdgkf
    gytdftwhptagtyyyvcqipghaatgmfgkivvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a3zA (A:)
    twkeatlpqvkamlekddgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkknptle
    ipagatvdvtfintnkgfghsfditkkgppyavmpvidpivagtgfspvpkdgkfgytdf
    twhptagtyyyvcqipghaatgmfgkivvk