PDB entry 1a3y

View 1a3y on RCSB PDB site
Description: odorant binding protein from nasal mucosa of pig
Class: lipocalin
Keywords: lipocalin, olfaction
Deposited on 1998-01-27, released 1999-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.181
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: odorant binding protein
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a3ya_
  • Chain 'B':
    Compound: odorant binding protein
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a3yb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a3yA (A:)
    pfelsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffskengiceefsl
    igtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgkgtdiedqd
    lekfkevtrengipeenivniierddcpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a3yB (B:)
    pfelsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffskengiceefsl
    igtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgkgtdiedqd
    lekfkevtrengipeenivniierddcpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a3yB (B:)
    elsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffskengiceefslig
    tkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgkgtdiedqdle
    kfkevtrengipeenivniierddcpa