PDB entry 1a3x

View 1a3x on RCSB PDB site
Description: pyruvate kinase from saccharomyces cerevisiae complexed with pg, mn2+ and k+
Deposited on 1998-01-26, released 1998-05-27
The last revision prior to the SCOP 1.71 freeze date was dated 1999-10-12, with a file datestamp of 1999-10-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.227
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a3xA (A:)
    msrlerltslnvvagsdlrrtsiigtigpktnnpetlvalrkaglnivrmnfshgsyeyh
    ksvidnarkseelypgrplaialdtkgpeirtgtttndvdypippnhemifttddkyaka
    cddkimyvdyknitkvisagriiyvddgvlsfqvlevvddktlkvkalnagkicshkgvn
    lpgtdvdlpalsekdkedlrfgvkngvhmvfasfirtandvltirevlgeqgkdvkiivk
    ienqqgvnnfdeilkvtdgvmvargdlgieipapevlavqkkliaksnlagkpvicatqm
    lesmtynprptraevsdvgnaildgadcvmlsgetakgnypinavttmaetaviaeqaia
    ylpnyddmrnctpkptsttetvaasavaavfeqkakaiivlstsgttprlvskyrpncpi
    ilvtrcpraarfshlyrgvfpfvfekepvsdwtddvearinfgiekakefgilkkgdtyv
    siqgfkagaghsntlqvstv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a3xA (A:)
    msrlerltslnvvagsdlrrtsiigtigpktnnpetlvalrkaglnivrmnfshgsyeyh
    ksvidnarkseelypgrplaialdtkgpeirtgtttndvdypippnhemifttddkyaka
    cddkimyvdyknitkvisagriiyvddgvlsfqvlevvddktlkvkalnagkicshkgvn
    lpgtdvdlpalsekdkedlrfgvkngvhmvfasfirtandvltirevlgeqgkdvkiivk
    ienqqgvnnfdeilkvtdgvmvargdlgieipapevlavqkkliaksnlagkpvicatqm
    lesmtynprptraevsdvgnaildgadcvmlsgetakgnypinavttmaetaviaeqaia
    ylpnyddmrnctpkptsttetvaasavaavfeqkakaiivlstsgttprlvskyrpncpi
    ilvtrcpraarfshlyrgvfpfvfeketddvearinfgiekakefgilkkgdtyvsiqgn
    tlqvstv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a3xB (B:)
    msrlerltslnvvagsdlrrtsiigtigpktnnpetlvalrkaglnivrmnfshgsyeyh
    ksvidnarkseelypgrplaialdtkgpeirtgtttndvdypippnhemifttddkyaka
    cddkimyvdyknitkvisagriiyvddgvlsfqvlevvddktlkvkalnagkicshkgvn
    lpgtdvdlpalsekdkedlrfgvkngvhmvfasfirtandvltirevlgeqgkdvkiivk
    ienqqgvnnfdeilkvtdgvmvargdlgieipapevlavqkkliaksnlagkpvicatqm
    lesmtynprptraevsdvgnaildgadcvmlsgetakgnypinavttmaetaviaeqaia
    ylpnyddmrnctpkptsttetvaasavaavfeqkakaiivlstsgttprlvskyrpncpi
    ilvtrcpraarfshlyrgvfpfvfekepvsdwtddvearinfgiekakefgilkkgdtyv
    siqgfkagaghsntlqvstv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a3xB (B:)
    msrlerltslnvvagsdlrrtsiigtigpktnnpetlvalrkaglnivrmnfshgsyeyh
    ksvidnarkseelypgrplaialdtkgpeirtgtttndvdypippnhemifttddkyaka
    cddkimyvdyknitkvisagriiyvddgvlsfqvlevvddktlkvkalnagkicshkgvn
    lpgtdvdlpalsekdkedlrfgvkngvhmvfasfirtandvltirevlgeqgkdvkiivk
    ienqqgvnnfdeilkvtdgvmvargdlgieipapevlavqkkliaksnlagkpvicatqm
    lesmtynprptraevsdvgnaildgadcvmlsgetakgnypinavttmaetaviaeqaia
    ylpnyddmrnctpkptsttetvaasavaavfeqkakaiivlstsgttprlvskyrpncpi
    ilvtrcpraarfshlyrgvfpfvfeketddvearinfgiekakefgilkkgdtyvsiqgn
    tlqvstv