PDB entry 1a3w

View 1a3w on RCSB PDB site
Description: pyruvate kinase from saccharomyces cerevisiae complexed with fbp, pg, mn2+ and k+
Class: transferase
Keywords: pyruvate kinase, allosteric regulation, tranferase, transferase
Deposited on 1998-01-26, released 1998-05-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.218
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate kinase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1a3wa1, d1a3wa2, d1a3wa3
  • Chain 'B':
    Compound: pyruvate kinase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1a3wb1, d1a3wb2, d1a3wb3
  • Heterogens: PGA, FBP, MN, K

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a3wA (A:)
    msrlerltslnvvagsdlrrtsiigtigpktnnpetlvalrkaglnivrmnfshgsyeyh
    ksvidnarkseelypgrplaialdtkgpeirtgtttndvdypippnhemifttddkyaka
    cddkimyvdyknitkvisagriiyvddgvlsfqvlevvddktlkvkalnagkicshkgvn
    lpgtdvdlpalsekdkedlrfgvkngvhmvfasfirtandvltirevlgeqgkdvkiivk
    ienqqgvnnfdeilkvtdgvmvargdlgieipapevlavqkkliaksnlagkpvicatqm
    lesmtynprptraevsdvgnaildgadcvmlsgetakgnypinavttmaetaviaeqaia
    ylpnyddmrnctpkptsttetvaasavaavfeqkakaiivlstsgttprlvskyrpncpi
    ilvtrcpraarfshlyrgvfpfvfekepvsdwtddvearinfgiekakefgilkkgdtyv
    siqgfkagaghsntlqvstv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a3wA (A:)
    srlerltslsdlrrtsiigtigpktnnpetlvalrkaglnivrmnfshgsyeyhksvidn
    arkseelypgrplaialdtkgpeirtgtttndvdypippnhemifttddkyakacddkim
    yvdyknitkvisagriiyvddgvlsfqvlevvdtlkvkalnagkicshkgvnlpgtdvdl
    palsekdkedlrfgvkngvhmvfasfirtandvltirevlgeqgkdvkiivkienqqgvn
    nfdeilkvtdgvmvargdlgieipapevlavqkkliaksnlagkpvicatqmlesmtynp
    rptraevsdvgnaildgadcvmlsgetakgnypinavttmaetaviaeqaiaylpnyddm
    rnctpkptsttetvaasavaavfeqkakaiivlstsgttprlvskyrpncpiilvtrcpr
    aarfshlyrgvfpfvfekepvsdwtddvearinfgiekakefgilkkgdtyvsiqgfkag
    aghsntlqvstv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a3wB (B:)
    msrlerltslnvvagsdlrrtsiigtigpktnnpetlvalrkaglnivrmnfshgsyeyh
    ksvidnarkseelypgrplaialdtkgpeirtgtttndvdypippnhemifttddkyaka
    cddkimyvdyknitkvisagriiyvddgvlsfqvlevvddktlkvkalnagkicshkgvn
    lpgtdvdlpalsekdkedlrfgvkngvhmvfasfirtandvltirevlgeqgkdvkiivk
    ienqqgvnnfdeilkvtdgvmvargdlgieipapevlavqkkliaksnlagkpvicatqm
    lesmtynprptraevsdvgnaildgadcvmlsgetakgnypinavttmaetaviaeqaia
    ylpnyddmrnctpkptsttetvaasavaavfeqkakaiivlstsgttprlvskyrpncpi
    ilvtrcpraarfshlyrgvfpfvfekepvsdwtddvearinfgiekakefgilkkgdtyv
    siqgfkagaghsntlqvstv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a3wB (B:)
    srlerltslsdlrrtsiigtigpktnnpetlvalrkaglnivrmnfshgsyeyhksvidn
    arkseelypgrplaialdtkgpeirtgtttndpippnhemifttddkyakacddkimyvd
    yknitkvisagriiyvddgvlsfqvlevvdtlkvkalnagkicshkgvnlpgtdvdlpal
    sekdkedlrfgvkngvhmvfasfirtandvltirevlgeqgkdvkiivkienqqgvnnfd
    eilkvtdgvmvargdlgieipapevlavqkkliaksnlagkpvicatqmlesmtynprpt
    raevsdvgnaildgadcvmlsgetakgnypinavttmaetaviaeqaiaylpnyddmrnc
    tpkptsttetvaasavaavfeqkakaiivlstsgttprlvskyrpncpiilvtrcpraar
    fshlyrgvfpfvfekepvsdwtddvearinfgiekakefgilkkgdtyvsiqgfkagagh
    sntlqvstv