PDB entry 1a3u

View 1a3u on RCSB PDB site
Description: staphylococcal nuclease, cyclohexane thiol disulfide to v23c variant
Deposited on 1998-01-24, released 1998-04-29
The last revision prior to the SCOP 1.55 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.169
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1a3u__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a3u_ (-)
    lhkepatlikaidgdtcklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
    kseaqakkeklniws