PDB entry 1a3t

View 1a3t on RCSB PDB site
Description: staphylococcal nuclease, v23c variant, complex with 2-fluoroethane thiol and 3',5'-thymidine diphosphate
Deposited on 1998-01-24, released 1998-04-29
The last revision prior to the SCOP 1.55 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.162
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1a3t__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a3t_ (-)
  lhkepatlikaidgdtcklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
  enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
  kseaqakkeklniws