PDB entry 1a3r

View 1a3r on RCSB PDB site
Description: fab fragment (antibody 8f5) complexed with peptide from human rhinovirus (serotype 2) viral capsid protein vp2 (residues 156-170)
Class: Viral protein/Immune system
Keywords: immunoglobulin, antibody, rhinovirus, neutralization, continuous epitope, complex (immunoglobulin/viral peptide)
Deposited on 1998-01-23, released 1998-04-29
The last revision prior to the SCOP 1.73 freeze date was dated 1998-04-29, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.171
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2a 8f5 fab (heavy chain)
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99L31 (Start-217)
      • conflict (12)
      • conflict (15)
      • conflict (23)
      • conflict (31)
      • conflict (34)
      • conflict (50)
      • conflict (56)
      • conflict (58-59)
      • conflict (62)
      • conflict (64)
      • conflict (71)
      • conflict (81-82)
      • insertion (96-100)
      • conflict (101-103)
      • conflict (103)
      • conflict (105)
      • conflict (109)
      • conflict (112)
      • conflict (117)
    Domains in SCOP 1.73: d1a3rh1, d1a3rh2
  • Chain 'L':
    Compound: igg2a 8f5 fab (light chain)
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VCI6 (0-219)
      • conflict (11)
      • conflict (13-14)
      • conflict (17)
      • conflict (21)
      • conflict (26)
      • conflict (33)
      • conflict (37)
      • conflict (39)
      • conflict (48)
      • conflict (55)
      • conflict (79)
      • conflict (82)
      • conflict (96-98)
    Domains in SCOP 1.73: d1a3rl1, d1a3rl2
  • Chain 'P':
    Compound: human rhinovirus capsid protein vp2
    Species: Human rhinovirus 2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NH2, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1a3rH (H:)
    evqlqqsgaelvrpgasvklscttsgfnikdiyihwvkqrpeqglewigrldpangytky
    dpkfqgkatitvdtssntaylhlssltsedtavyycdgyysyydmdywgpgtsvtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a3rH (H:)
    vqlqqsgaelvrpgasvklscttsgfnikdiyihwvkqrpeqglewigrldpangytkyd
    pkfqgkatitvdtssntaylhlssltsedtavyycdgyysyydmdywgpgtsvtvssakt
    tapsvyplapvcssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssv
    tvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a3rL (L:)
    divmtqspssltvttgekvtmtckssqsllnsrtqknyltwyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftlsisgvqaedlavyycqnnynypltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    No sequence available.