PDB entry 1a3p

View 1a3p on RCSB PDB site
Description: role of the 6-20 disulfide bridge in the structure and activity of epidermal growth factor, nmr, 20 structures
Class: growth factor
Keywords: growth factor, murine epidermal growth factor, disulfide connectivities, egf-like domain, repeat
Deposited on 1998-01-22, released 1998-07-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epidermal growth factor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01132 (0-44)
      • mutation (2)
      • mutation (16)
    Domains in SCOPe 2.03: d1a3pa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a3pA (A:)
    pgapssydgyclnggvamhiesldsytcncvigysgdrcqtrdlr