PDB entry 1a3l

View 1a3l on RCSB PDB site
Description: catalysis of a disfavored reaction: an antibody exo diels-alderase-tsa-inhibitor complex at 1.95 a resolution
Class: immunoglobulin
Keywords: diels-alder, disfavored reaction, catalytic antibody, immunoglobulin
Deposited on 1998-01-22, released 1999-02-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.188
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin fab 13g5 (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA69274 (0-217)
      • conflict (2)
      • conflict (4)
      • conflict (9)
      • conflict (44)
      • conflict (55)
      • conflict (58-59)
      • conflict (64)
      • conflict (68)
      • conflict (98)
      • conflict (100-101)
      • conflict (103)
      • conflict (103)
      • conflict (107)
      • conflict (113)
    Domains in SCOPe 2.03: d1a3lh1, d1a3lh2
  • Chain 'L':
    Compound: immunoglobulin fab 13g5 (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB50767 (0-216)
      • conflict (2-3)
      • conflict (6-8)
      • conflict (10)
      • conflict (13)
      • conflict (16-17)
      • conflict (26)
      • conflict (26)
      • conflict (26)
      • conflict (34-38)
      • conflict (49)
      • conflict (54-55)
      • conflict (58-59)
      • conflict (62)
      • conflict (78)
      • conflict (87)
      • conflict (93)
      • conflict (95-98)
      • conflict (100)
      • conflict (172)
      • conflict (187)
    Domains in SCOPe 2.03: d1a3ll1, d1a3ll2
  • Heterogens: CFC, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a3lH (H:)
    evqleesgpelvrpgtsvkisckasgytftnywlgwvkqrpghgfewigdiypggvyttn
    nekfrgkailtadtssstaymqlssltsedsavyfcaraggyytggdywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a3lL (L:)
    divltqaafsnpvtlgasasiscrssksllnsngiihmywylqkpgqspqlliyqmskla
    sgapdrfsgsgsgtdftlrisrveaedvgvyycaqnlelpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdtkdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn