PDB entry 1a3l

View 1a3l on RCSB PDB site
Description:
Deposited on 1998-01-22, released 1999-02-16
The last revision prior to the SCOP 1.65 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.1881
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1a3lh1, d1a3lh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1a3ll1, d1a3ll2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a3lH (H:)
    evqleesgpelvrpgtsvkisckasgytftnywlgwvkqrpghgfewigdiypggvyttn
    nekfrgkailtadtssstaymqlssltsedsavyfcaraggyytggdywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a3lL (L:)
    divltqaafsnpvtlgasasiscrssksllnsngiihmywylqkpgqspqlliyqmskla
    sgapdrfsgsgsgtdftlrisrveaedvgvyycaqnlelpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdtkdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn