PDB entry 1a3g

View 1a3g on RCSB PDB site
Description: branched-chain amino acid aminotransferase from escherichia coli
Class: aminotransferase
Keywords: aminotransferase, pyridoxal enzyme
Deposited on 1998-01-21, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.188
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: branched-chain amino acid aminotransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a3ga_
  • Chain 'B':
    Compound: branched-chain amino acid aminotransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a3gb_
  • Chain 'C':
    Compound: branched-chain amino acid aminotransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a3gc_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a3gA (A:)
    ttkkadyiwfngemvrwedakvhvmshalhygtsvfegircydshkgpvvfrhrehmqrl
    hdsakiyrfpvsqsidelmeacrdvirknnltsayirplifvgdvgmgvnppagystdvi
    iaafpwgaylgaealeqgidamvsswnraapntiptaakaggnylssllvgsearrhgyq
    egialdvngyisegagenlfevkdgvlftppftssalpgitrdaiiklakelgievreqv
    lsreslyladevfmsgtaaeitpvrsvdgiqvgegrcgpvtkriqqaffglftgetedkw
    gwldqvnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a3gA (A:)
    kadyiwfngemvrwedakvhvmshalhygtsvfegircydshkgpvvfrhrehmqrlhds
    akiyrfpvsqsidelmeacrdvirknnltsayirplifvgdvgmgvnppagystdviiaa
    fpwqgidamvsswnraapntiptaakaggnylssllvgsearrhgyqegialdvngyise
    gagenlfevkdgvlftppftssalpgitrdaiiklakelgievreqvlsreslyladevf
    msgtaaeitpvrsvdgiqvgegrcgpvtkriqqaffglftgetedkwgwldqvnq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a3gB (B:)
    ttkkadyiwfngemvrwedakvhvmshalhygtsvfegircydshkgpvvfrhrehmqrl
    hdsakiyrfpvsqsidelmeacrdvirknnltsayirplifvgdvgmgvnppagystdvi
    iaafpwgaylgaealeqgidamvsswnraapntiptaakaggnylssllvgsearrhgyq
    egialdvngyisegagenlfevkdgvlftppftssalpgitrdaiiklakelgievreqv
    lsreslyladevfmsgtaaeitpvrsvdgiqvgegrcgpvtkriqqaffglftgetedkw
    gwldqvnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a3gB (B:)
    kadyiwfngemvrwedakvhvmshalhygtsvfegircydshkgpvvfrhrehmqrlhds
    akiyrfpvsqsidelmeacrdvirknnltsayirplifvgdvgmgvnppagystdviiaa
    fpwqgidamvsswnraapntiptaakaggnylssllvgsearrhgyqegialdvngyise
    gagenlfevkdgvlftppftssalpgitrdaiiklakelgievreqvlsreslyladevf
    msgtaaeitpvrsvdgiqvgegrcgpvtkriqqaffglftgetedkwgwldqvnq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1a3gC (C:)
    ttkkadyiwfngemvrwedakvhvmshalhygtsvfegircydshkgpvvfrhrehmqrl
    hdsakiyrfpvsqsidelmeacrdvirknnltsayirplifvgdvgmgvnppagystdvi
    iaafpwgaylgaealeqgidamvsswnraapntiptaakaggnylssllvgsearrhgyq
    egialdvngyisegagenlfevkdgvlftppftssalpgitrdaiiklakelgievreqv
    lsreslyladevfmsgtaaeitpvrsvdgiqvgegrcgpvtkriqqaffglftgetedkw
    gwldqvnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a3gC (C:)
    kadyiwfngemvrwedakvhvmshalhygtsvfegircydshkgpvvfrhrehmqrlhds
    akiyrfpvsqsidelmeacrdvirknnltsayirplifvgdvgmgvnppagystdviiaa
    fpwqgidamvsswnraapntiptaakaggnylssllvgsearrhgyqegialdvngyise
    gagenlfevkdgvlftppftssalpgitrdaiiklakelgievreqvlsreslyladevf
    msgtaaeitpvrsvdgiqvgegrcgpvtkriqqaffglftgetedkwgwldqvnq