PDB entry 1a3f

View 1a3f on RCSB PDB site
Description: phospholipase a2 (pla2) from naja naja venom
Class: carboxylic ester hydrolase
Keywords: phospholipase, trimer, calcium binding, activator site, carboxylic ester hydrolase
Deposited on 1998-01-21, released 1998-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.21
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Naja naja [TaxId:35670]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a3fa_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Naja naja [TaxId:35670]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a3fb_
  • Chain 'C':
    Compound: phospholipase a2
    Species: Naja naja [TaxId:35670]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a3fc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a3fA (A:)
nlyqfknmikctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
wpyfktysyecsqgtltckgdnnacaasvcdcdrlaaicfagapyndnnynidlkarcq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a3fB (B:)
nlyqfknmikctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
wpyfktysyecsqgtltckgdnnacaasvcdcdrlaaicfagapyndnnynidlkarcq

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a3fC (C:)
nlyqfknmikctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
wpyfktysyecsqgtltckgdnnacaasvcdcdrlaaicfagapyndnnynidlkarcq