PDB entry 1a3d

View 1a3d on RCSB PDB site
Description: phospholipase a2 (pla2) from naja naja venom
Class: carboxylic ester hydrolase
Keywords: phospholipase, trimer, calcium binding, activator site, carboxylic ester hydrolase
Deposited on 1998-01-20, released 1998-04-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Naja naja [TaxId:35670]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1a3da_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a3dA (A:)
    nlyqfknmikctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
    wpyfktysyecsqgtltckgdnnacaasvcdcdrlaaicfagapyndnnynidlkarcq