PDB entry 1a3c

View 1a3c on RCSB PDB site
Description: pyrr, the bacillus subtilis pyrimidine biosynthetic operon repressor, dimeric form
Deposited on 1998-01-20, released 1998-08-05
The last revision prior to the SCOP 1.55 freeze date was dated 1998-08-05, with a file datestamp of 1998-08-05.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.192
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1a3c__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1a3c_ (-)
    qkavildeqairraltriahemiernkgmnncilvgiktrgiylakrlaerieqiegnpv
    tvgeiditlyrddlskktsndeplvkgadipvditdqkvilvddvlytgrtvragmdalv
    dvgrpssiqlavlvdrghrelpiradyigkniptsksekvmvqldevdqndlvaiyen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a3c_ (-)
    qkavildeqairraltriahemiernkcilvgiktrgiylakrlaerieqiegnpvtvge
    iditlyrndeplvkgadipvditdqkvilvddvlytgrtvragmdalvdvgrpssiqlav
    lvdrghrelpiradyigkniptsksekvmvqldevdqndlvaiyen