PDB entry 1a3c

View 1a3c on RCSB PDB site
Description: pyrr, the bacillus subtilis pyrimidine biosynthetic operon repressor, dimeric form
Class: transcription regulation
Keywords: transcription regulation, attenuation protein, RNA-binding protein, pyrimidine biosynthesis, transferase, prtase, phosphoribosyltransferase, bifunctional enzyme
Deposited on 1998-01-20, released 1998-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.192
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyrimidine operon regulatory protein pyrr
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PYRR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a3ca_
  • Heterogens: SM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a3cA (A:)
    mnqkavildeqairraltriahemiernkgmnncilvgiktrgiylakrlaerieqiegn
    pvtvgeiditlyrddlskktsndeplvkgadipvditdqkvilvddvlytgrtvragmda
    lvdvgrpssiqlavlvdrghrelpiradyigkniptsksekvmvqldevdqndlvaiyen
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a3cA (A:)
    qkavildeqairraltriahemiernkcilvgiktrgiylakrlaerieqiegnpvtvge
    iditlyrndeplvkgadipvditdqkvilvddvlytgrtvragmdalvdvgrpssiqlav
    lvdrghrelpiradyigkniptsksekvmvqldevdqndlvaiyen