PDB entry 1a3a

View 1a3a on RCSB PDB site
Description: crystal structure of iia mannitol from escherichia coli
Class: phosphotransferase
Keywords: phosphoenolpyruvate dependent phosphotransferase system, iia enzymes, histidine phosphorylation, phosphotransferase
Deposited on 1998-01-19, released 1998-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannitol-specific eii
    Species: Escherichia coli [TaxId:83333]
    Gene: MTLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a3aa_
  • Chain 'B':
    Compound: mannitol-specific eii
    Species: Escherichia coli [TaxId:83333]
    Gene: MTLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a3ab_
  • Chain 'C':
    Compound: mannitol-specific eii
    Species: Escherichia coli [TaxId:83333]
    Gene: MTLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a3ac_
  • Chain 'D':
    Compound: mannitol-specific eii
    Species: Escherichia coli [TaxId:83333]
    Gene: MTLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a3ad_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a3aA (A:)
    manlfklgaeniflgrkaatkeeairfageqlvkggyvepeyvqamldrekltptylges
    iavphgtveakdrvlktgvvfcqypegvrfgeeeddiarlvigiaarnnehiqvitsltn
    alddesvierlahttsvdevlellagrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a3aA (A:)
    lfklgaeniflgrkaatkeeairfageqlvkggyvepeyvqamldrekltptylgesiav
    phgtveakdrvlktgvvfcqypegvrfgeeeddiarlvigiaarnnehiqvitsltnald
    desvierlahttsvdevlellagrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a3aB (B:)
    manlfklgaeniflgrkaatkeeairfageqlvkggyvepeyvqamldrekltptylges
    iavphgtveakdrvlktgvvfcqypegvrfgeeeddiarlvigiaarnnehiqvitsltn
    alddesvierlahttsvdevlellagrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a3aB (B:)
    fklgaeniflgrkaatkeeairfageqlvkggyvepeyvqamldrekltptylgesiavp
    hgtveakdrvlktgvvfcqypegvrfgeeeddiarlvigiaarnnehiqvitsltnaldd
    esvierlahttsvdevlella
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1a3aC (C:)
    manlfklgaeniflgrkaatkeeairfageqlvkggyvepeyvqamldrekltptylges
    iavphgtveakdrvlktgvvfcqypegvrfgeeeddiarlvigiaarnnehiqvitsltn
    alddesvierlahttsvdevlellagrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a3aC (C:)
    nlfklgaeniflgrkaatkeeairfageqlvkggyvepeyvqamldrekltptylgesia
    vphgtveakdrvlktgvvfcqypegvrfgeeeddiarlvigiaarnnehiqvitsltnal
    ddesvierlahttsvdevlellagrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1a3aD (D:)
    manlfklgaeniflgrkaatkeeairfageqlvkggyvepeyvqamldrekltptylges
    iavphgtveakdrvlktgvvfcqypegvrfgeeeddiarlvigiaarnnehiqvitsltn
    alddesvierlahttsvdevlellagrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a3aD (D:)
    lfklgaeniflgrkaatkeeairfageqlvkggyvepeyvqamldrekltptylgesiav
    phgtveakdrvlktgvvfcqypegvrfgeeeddiarlvigiaarnnehiqvitsltnald
    desvierlahttsvdevlellagr