PDB entry 1a39

View 1a39 on RCSB PDB site
Description: humicola insolens endocellulase egi s37w, p39w double-mutant
Class: hydrolase
Keywords: endoglucanase, hydrolase, cellulase, cellulose degradation, glycoside hydrolase family 7, glycosylated protein
Deposited on 1998-01-28, released 1999-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase I
    Species: Humicola insolens [TaxId:34413]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56680 (1-401)
      • conflict (36)
      • conflict (38)
    Domains in SCOPe 2.07: d1a39a_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a39A (A:)
    ekpgetkevhpqlttfrctkrggckpatnfivldslwhwihraeglgpggcgdwgnpppk
    dvcpdvescakncimegipdysqygvttngtslrlqhilpdgrvpsprvylldktkrrye
    mlhltgfeftfdvdatklpcgmnsalylsemhptgakskynpggayygtgycdaqcfvtp
    finglgniegkgsccnemdiweansrashvaphtcnkkglylcegeecafegvcdkngcg
    wnnyrvnvtdyygrgeefkvntlkpftvvtqflanrrgklekihrfyvqdgkviesfytn
    kegvpytnmiddefceatgsrkymelgatqgmgealtrgmvlamsiwwdqggnmewldhg
    eagpcakgegapsnivqvepfpevtytnlrwgeigstyqelq