PDB entry 1a38

View 1a38 on RCSB PDB site
Description: 14-3-3 protein zeta bound to r18 peptide
Class: complex (signal transduction/peptide)
Keywords: signal transduction, complex (signal transduction/peptide)
Deposited on 1998-01-28, released 1999-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.35 Å
R-factor: 0.33
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein zeta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a38a_
  • Chain 'B':
    Compound: 14-3-3 protein zeta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a38b_
  • Chain 'P':
    Compound: r18 peptide (phcvprdlswldleanmclp)
    Database cross-references and differences (RAF-indexed):
    • PDB 1A38
  • Chain 'Q':
    Compound: r18 peptide (phcvprdlswldleanmclp)
    Database cross-references and differences (RAF-indexed):
    • PDB 1A38

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a38A (A:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwtsdtqgdeaeag
    eggen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a38A (A:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkmkgdy
    yrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyeilnsp
    ekacslaktafdeaiaesykdstlimqllrdnltlw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a38B (B:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwtsdtqgdeaeag
    eggen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a38B (B:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkmkgdy
    yrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyeilnsp
    ekacslaktafdeaiaesykdstlimqllrdnltlw
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.