PDB entry 1a37

View 1a37 on RCSB PDB site
Description: 14-3-3 protein zeta bound to ps-raf259 peptide
Class: complex (signal transduction/peptide)
Keywords: SIGNAL TRANSDUCTION, COMPLEX (SIGNAL TRANSDUCTION-PEPTIDE), COMPLEX (SIGNAL TRANSDUCTION-PEPTIDE) complex
Deposited on 1998-01-28, released 1999-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: 0.32
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein zeta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1a37a_
  • Chain 'B':
    Compound: 14-3-3 protein zeta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1a37b_
  • Chain 'P':
    Compound: ps-raf259 peptide lsqrqrst(pse)tpnvhm
    Database cross-references and differences (RAF-indexed):
    • PDB 1A37
  • Chain 'Q':
    Compound: ps-raf259 peptide lsqrqrst(pse)tpnvhm
    Database cross-references and differences (RAF-indexed):
    • PDB 1A37

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a37A (A:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwtsdtqgdeaeag
    eggen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a37A (A:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqekkqqmareyrekietelrdicndvlsllekflipnaaeskvfylkmkgdyyr
    ylaevaagddkkgivdqsqqayqeafeiskirlglalnfsvfyyacslaktafdeaiadd
    stlimqllrdnltlw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a37B (B:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwtsdtqgdeaeag
    eggen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a37B (B:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqekkqqmareyrekietelrdicndvlsllekflipnaaeskvfylkmkgdyyr
    ylaevaagddkkgivdqsqqayqeafeiskirlglalnfsvfyyacslaktafdeaiadd
    stlimqllrdnltlw
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.