PDB entry 1a36

View 1a36 on RCSB PDB site
Description: topoisomerase I/DNA complex
Class: isomerase/DNA
Keywords: complex (isomerase/DNA), DNA, topoisomerase I
Deposited on 1998-01-29, released 1998-08-12
The last revision prior to the SCOP 1.75 freeze date was dated 1998-08-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: topoisomerase I
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11387 (Start-590)
      • engineered (548)
    Domains in SCOP 1.75: d1a36a1, d1a36a2, d1a36a3
  • Chain 'B':
    Compound: DNA (5'-d(*ap*ap*ap*ap*ap*gp*ap*cp*tp*tp*ap*gp*ap*ap*ap*ap*a p*tp*tp*tp*tp*t)- 3')
  • Chain 'C':
    Compound: DNA (5'-d(*ap*ap*ap*ap*ap*tp*tp*tp*tp*tp*cp*tp*ap*ap*gp*tp*c p*tp*tp*tp*tp*t)- 3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a36A (A:)
    kpknkdkdkkvpepdnkkkkpkkeeeqkwkwweeerypegikwkflehkgpvfappyepl
    penvkfyydgkvmklspkaeevatffakmldheyttkeifrknffkdwrkemtneeknii
    tnlskcdftqmsqyfkaqtearkqmskeeklkikeenekllkeygfcimdnhkerianfk
    ieppglfrgrgnhpkmgmlkrrimpediiincskdakvpspppghkwkevrhdnkvtwlv
    swteniqgsikyimlnpssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrq
    ravalyfidklalragnekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkds
    iryynkvpvekrvfknlqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtyna
    sitlqqqlkeltapdenipakilsynranravailcnhqrappktfeksmmnlqtkidak
    keqladarrdlksakadakvmkdaktkkvveskkkavqrleeqlmklevqatdreenkqi
    algtsklnfldpritvawckkwgvpiekiynktqrekfawaidmadedyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a36A (A:)
    ikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffakmldheyttkeif
    rknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmskeeklkikeenekl
    lkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpediiincskdakvps
    pppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekdwqkyetarrlkkcv
    dkirnqyredwkskemkvrqravalyfidklalragnekeegetadtvgccslrvehinl
    hpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqpeddlfdrlntgiln
    khlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsynranravailcnhqe
    ksmmnlqtkidakkeqladarrdlksakadakvmkdaktkkvveskkkavqrleeqlmkl
    evqatdreenkqialgtsklnfldpritvawckkwgvpiekiynktqrekfawaidmade
    dyef
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.