PDB entry 1a36

View 1a36 on RCSB PDB site
Description: topoisomerase i/dna complex
Deposited on 1998-01-29, released 1998-08-12
The last revision prior to the SCOP 1.67 freeze date was dated 1998-08-12, with a file datestamp of 1998-08-12.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a36A (A:)
    kkpknkdkdkkvpepdnkkkkpkkeeeqkwkwweeerypegikwkflehkgpvfappyep
    lpenvkfyydgkvmklspkaeevatffakmldheyttkeifrknffkdwrkemtneekni
    itnlskcdftqmsqyfkaqtearkqmskeeklkikeenekllkeygfcimdnhkerianf
    kieppglfrgrgnhpkmgmlkrrimpediiincskdakvpspppghkwkevrhdnkvtwl
    vswteniqgsikyimlnpssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvr
    qravalyfidklalragnekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkd
    siryynkvpvekrvfknlqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtyn
    asitlqqqlkeltapdenipakilsynranravailcnhqrappktfeksmmnlqtkida
    kkeqladarrdlksakadakvmkdaktkkvveskkkavqrleeqlmklevqatdreenkq
    ialgtsklnfldpritvawckkwgvpiekiynktqrekfawaidmadedyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a36A (A:)
    ikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffakmldheyttkeif
    rknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmskeeklkikeenekl
    lkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpediiincskdakvps
    pppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekdwqkyetarrlkkcv
    dkirnqyredwkskemkvrqravalyfidklalragnekeegetadtvgccslrvehinl
    hpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqpeddlfdrlntgiln
    khlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsynranravailcnhqe
    ksmmnlqtkidakkeqladarrdlksakadakvmkdaktkkvveskkkavqrleeqlmkl
    evqatdreenkqialgtsklnfldpritvawckkwgvpiekiynktqrekfawaidmade
    dyef