PDB entry 1a35

View 1a35 on RCSB PDB site
Description: human topoisomerase i/dna complex
Deposited on 1998-01-29, released 1998-08-26
The last revision prior to the SCOP 1.67 freeze date was dated 1998-08-26, with a file datestamp of 1998-08-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a35A (A:)
    kpknkdkdkkvpepdnkkkkpkkeeeqkwkwweeerypegikwkflehkgpvfappyepl
    penvkfyydgkvmklspkaeevatffakmldheyttkeifrknffkdwrkemtneeknii
    tnlskcdftqmsqyfkaqtearkqmskeeklkikeenekllkeygfcimdnhkerianfk
    ieppglfrgrgnhpkmgmlkrrimpediiincskdakvpspppghkwkevrhdnkvtwlv
    swteniqgsikyimlnpssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrq
    ravalyfidklalragnekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkds
    iryynkvpvekrvfknlqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtyna
    sitlqqqlkeltapdenipakilsynranravailcnhqrappktfeksmmnlqtkidak
    keqlaqialgtsklnfldpritvawckkwgvpiekiynktqrekfawaidmadedyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a35A (A:)
    ikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffakmldheyttkeif
    rknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmskeeklkikeenekl
    lkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpediiincskdakvps
    pppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekdwqkyetarrlkkcv
    dkirnqyredwkskemkvrqravalyfidklalragnekeegetadtvgccslrvehinl
    hpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqpeddlfdrlntgiln
    khlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsynranravailcnhqr
    aqialgtsklnfldpritvawckkwgvpiekiynktqrekfawaidmadedyef