PDB entry 1a35

View 1a35 on RCSB PDB site
Description: human topoisomerase I/DNA complex
Class: isomerase/DNA
Keywords: topoisomerase I/DNA), DNA, topoisomerase I, isomerase/DNA complex
Deposited on 1998-01-29, released 1998-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (DNA topoisomerase I)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11387 (Start-590)
      • engineered (548)
    Domains in SCOPe 2.07: d1a35a1, d1a35a2
  • Chain 'C':
    Compound: DNA (5'-d(*ap*ap*ap*ap*ap*gp*ap*cp*tp*tp*ap*gp*ap*ap*ap*ap*ap*(bru)p*(bru)p*tp*tp*t)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*ap*ap*ap*ap*ap*tp*+up*+up*+up*+up*cp*+up*ap*ap*gp*tp*cp*tp*tp*tp*+ up*t)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a35A (A:)
    kpknkdkdkkvpepdnkkkkpkkeeeqkwkwweeerypegikwkflehkgpvfappyepl
    penvkfyydgkvmklspkaeevatffakmldheyttkeifrknffkdwrkemtneeknii
    tnlskcdftqmsqyfkaqtearkqmskeeklkikeenekllkeygfcimdnhkerianfk
    ieppglfrgrgnhpkmgmlkrrimpediiincskdakvpspppghkwkevrhdnkvtwlv
    swteniqgsikyimlnpssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrq
    ravalyfidklalragnekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkds
    iryynkvpvekrvfknlqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtyna
    sitlqqqlkeltapdenipakilsynranravailcnhqrappktfeksmmnlqtkidak
    keqladarrdlksakadakvmkdaktkkvveskkkavqrleeqlmklevqatdreenkqi
    algtsklnfldpritvawckkwgvpiekiynktqrekfawaidmadedyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a35A (A:)
    ikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffakmldheyttkeif
    rknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmskeeklkikeenekl
    lkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpediiincskdakvps
    pppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekdwqkyetarrlkkcv
    dkirnqyredwkskemkvrqravalyfidklalragnekeegetadtvgccslrvehinl
    hpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqpeddlfdrlntgiln
    khlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsynranravailcnhqr
    aqialgtsklnfldpritvawckkwgvpiekiynktqrekfawaidmadedyef
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.