PDB entry 1a33

View 1a33 on RCSB PDB site
Description: peptidylprolyl isomerase, cyclophilin-like domain from brugia malayi
Deposited on 1998-01-27, released 1998-07-29
The last revision prior to the SCOP 1.55 freeze date was dated 1998-07-29, with a file datestamp of 1998-07-29.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.169
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1a33__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a33_ (-)
kdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgst
fhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsqf
fitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv