PDB entry 1a33

View 1a33 on RCSB PDB site
Description: peptidylprolyl isomerase, cyclophilin-like domain from brugia malayi
Class: isomerase
Keywords: isomerase, peptidyl-prolyl cis-trans, peptidylprolyl isomerase
Deposited on 1998-01-27, released 1998-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.169
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidylprolyl isomerase
    Species: Brugia malayi [TaxId:6279]
    Gene: BMCYP-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a33a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a33A (A:)
    mskkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhyk
    gstfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntng
    sqffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a33A (A:)
    kdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgst
    fhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsqf
    fitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv