PDB entry 1a31

View 1a31 on RCSB PDB site
Description: human reconstituted dna topoisomerase i in covalent complex with a 22 base pair dna duplex
Deposited on 1998-01-27, released 1998-08-19
The last revision prior to the SCOP 1.67 freeze date was dated 1998-08-19, with a file datestamp of 1998-08-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.247
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a31A (A:)
    kpknkdkdkkvpepdnkkkkpkkeeeqkwkwweeerypegikwkflehkgpvfappyepl
    penvkfyydgkvmklspkaeevatffakmldheyttkeifrknffkdwrkemtneeknii
    tnlskcdftqmsqyfkaqtearkqmskeeklkikeenekllkeygfcimdnhkerianfk
    ieppglfrgrgnhpkmgmlkrrimpediiincskdakvpspppghkwkevrhdnkvtwlv
    swteniqgsikyimlnpssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrq
    ravalyfidklalragnekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkds
    iryynkvpvekrvfknlqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtyna
    sitlqqqlkeltapdenipakilsynranravailcnhqrappktfeksmmnlqtkidak
    keqlaqialgtsklnyldpritvawckkwgvpiekiynktqrekfawaidmadedyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a31A (A:)
    ikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffakmldheyttkeif
    rknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmskeeklkikeenekl
    lkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpediiincskdakvps
    pppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekdwqkyetarrlkkcv
    dkirnqyredwkskemkvrqravalyfidklalragnekeegetadtvgccslrvehinl
    hpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqpeddlfdrlntgiln
    khlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsynranravklnyldpr
    itvawckkwgvpiekiynktqrekfawaidmadedyef