PDB entry 1a31

View 1a31 on RCSB PDB site
Description: human reconstituted DNA topoisomerase I in covalent complex with a 22 base pair DNA duplex
Class: isomerase/DNA
Keywords: topoisomerase I/DNA, DNA, topoisomerase I, isomerase/DNA complex
Deposited on 1998-01-27, released 1998-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.247
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (topoisomerase I)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11387 (Start-590)
      • modified residue (548)
    Domains in SCOPe 2.07: d1a31a1, d1a31a2
  • Chain 'C':
    Compound: DNA (5'-d(*ap*ap*ap*ap*ap*gp*ap*cp*5iup*5iu*tp*gp*ap*ap*ap*ap*ap*5iup*5iup*5iup*5iup*t)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*ap*ap*ap*ap*ap*tp*5iup*5iup*5iup*5iup*cp*ap*ap*ap*gp*tp*cp*tp*tp*tp*tp*t)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a31A (A:)
    kpknkdkdkkvpepdnkkkkpkkeeeqkwkwweeerypegikwkflehkgpvfappyepl
    penvkfyydgkvmklspkaeevatffakmldheyttkeifrknffkdwrkemtneeknii
    tnlskcdftqmsqyfkaqtearkqmskeeklkikeenekllkeygfcimdnhkerianfk
    ieppglfrgrgnhpkmgmlkrrimpediiincskdakvpspppghkwkevrhdnkvtwlv
    swteniqgsikyimlnpssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrq
    ravalyfidklalragnekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkds
    iryynkvpvekrvfknlqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtyna
    sitlqqqlkeltapdenipakilsynranravailcnhqrappktfeksmmnlqtkidak
    keqladarrdlksakadakvmkdaktkkvveskkkavqrleeqlmklevqatdreenkqi
    algtsklnyldpritvawckkwgvpiekiynktqrekfawaidmadedyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a31A (A:)
    ikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffakmldheyttkeif
    rknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmskeeklkikeenekl
    lkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpediiincskdakvps
    pppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekdwqkyetarrlkkcv
    dkirnqyredwkskemkvrqravalyfidklalragnekeegetadtvgccslrvehinl
    hpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqpeddlfdrlntgiln
    khlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsynranravklnyldpr
    itvawckkwgvpiekiynktqrekfawaidmadedyef
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.