PDB entry 1a2z

View 1a2z on RCSB PDB site
Description: pyrrolidone carboxyl peptidase from thermococcus litoralis
Class: peptidase
Keywords: peptidase, n-pyroglutamate hydrolysis
Deposited on 1998-01-13, released 1998-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.18
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyrrolidone carboxyl peptidase
    Species: Thermococcus litoralis [TaxId:2265]
    Gene: PCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a2za_
  • Chain 'B':
    Compound: pyrrolidone carboxyl peptidase
    Species: Thermococcus litoralis [TaxId:2265]
    Gene: PCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a2zb_
  • Chain 'C':
    Compound: pyrrolidone carboxyl peptidase
    Species: Thermococcus litoralis [TaxId:2265]
    Gene: PCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a2zc_
  • Chain 'D':
    Compound: pyrrolidone carboxyl peptidase
    Species: Thermococcus litoralis [TaxId:2265]
    Gene: PCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a2zd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2zA (A:)
    mkkvlitgfepfggdsknpteqiakyfdrkqignamvygrvlpvsvkratielkryleei
    kpeivinlglaptysnitveriavniidaripdndgyqpidekieedaplaymatlpvra
    itktlrdngipatisysagtylcnyvmfktlhfskiegyplkagfihvpytpdqvvnkff
    llgkntpsmcleaeikaielavkvsldylekdrddikipl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2zB (B:)
    mkkvlitgfepfggdsknpteqiakyfdrkqignamvygrvlpvsvkratielkryleei
    kpeivinlglaptysnitveriavniidaripdndgyqpidekieedaplaymatlpvra
    itktlrdngipatisysagtylcnyvmfktlhfskiegyplkagfihvpytpdqvvnkff
    llgkntpsmcleaeikaielavkvsldylekdrddikipl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2zC (C:)
    mkkvlitgfepfggdsknpteqiakyfdrkqignamvygrvlpvsvkratielkryleei
    kpeivinlglaptysnitveriavniidaripdndgyqpidekieedaplaymatlpvra
    itktlrdngipatisysagtylcnyvmfktlhfskiegyplkagfihvpytpdqvvnkff
    llgkntpsmcleaeikaielavkvsldylekdrddikipl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2zD (D:)
    mkkvlitgfepfggdsknpteqiakyfdrkqignamvygrvlpvsvkratielkryleei
    kpeivinlglaptysnitveriavniidaripdndgyqpidekieedaplaymatlpvra
    itktlrdngipatisysagtylcnyvmfktlhfskiegyplkagfihvpytpdqvvnkff
    llgkntpsmcleaeikaielavkvsldylekdrddikipl