PDB entry 1a2x

View 1a2x on RCSB PDB site
Description: complex of troponin c with a 47 residue (1-47) fragment of troponin i
Deposited on 1998-01-13, released 1998-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1998-07-15, with a file datestamp of 1998-07-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1a2xa_
  • Chain 'B':
    Domains in SCOP 1.55: d1a2xb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2xA (A:)
    dqqaearsylseemiaefkaafdmfdadgggdisvkelgtvmrmlgqtptkeeldaiiee
    vdedgsgtidfeeflvmmvrqmkedakgkseeelaecfrifdrnadgyidaeelaeifra
    sgehvtdeeieslmkdgdknndgridfdeflkmmegvq
    

  • Chain 'B':
    No sequence available.