PDB entry 1a2x

View 1a2x on RCSB PDB site
Description: complex of troponin c with a 47 residue (1-47) fragment of troponin I
Class: complex (skeletal muscle/muscle protein)
Keywords: troponin, muscle contraction regulation, complex (skeletal muscle/muscle protein)
Deposited on 1998-01-13, released 1998-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a2xa_
  • Chain 'B':
    Compound: troponin I
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a2xb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a2xA (A:)
    tdqqaearsylseemiaefkaafdmfdadgggdisvkelgtvmrmlgqtptkeeldaiie
    evdedgsgtidfeeflvmmvrqmkedakgkseeelaecfrifdrnadgyidaeelaeifr
    asgehvtdeeieslmkdgdknndgridfdeflkmmegvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a2xA (A:)
    dqqaearsylseemiaefkaafdmfdadgggdisvkelgtvmrmlgqtptkeeldaiiee
    vdedgsgtidfeeflvmmvrqmkedakgkseeelaecfrifdrnadgyidaeelaeifra
    sgehvtdeeieslmkdgdknndgridfdeflkmmegvq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a2xB (B:)
    gdeekrnraitarrqhlksvmlqiaatelekeegrreaekqnylaeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a2xB (B:)
    eekrnraitarrqhlksvmlqiaatelekee