PDB entry 1a2v

View 1a2v on RCSB PDB site
Description: copper amine oxidase from hansenula polymorpha
Class: amine oxidase
Keywords: amine oxidase, quinoprotein, topaquinone enzyme, tpq
Deposited on 1998-01-12, released 1998-05-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.184
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methylamine oxidase
    Species: Pichia angusta [TaxId:4905]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12807 (0-654)
      • modified residue (387)
    Domains in SCOPe 2.06: d1a2va1, d1a2va2, d1a2va3
  • Chain 'B':
    Compound: methylamine oxidase
    Species: Pichia angusta [TaxId:4905]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12807 (0-654)
      • modified residue (387)
    Domains in SCOPe 2.06: d1a2vb1, d1a2vb2, d1a2vb3
  • Chain 'C':
    Compound: methylamine oxidase
    Species: Pichia angusta [TaxId:4905]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12807 (0-654)
      • modified residue (387)
    Domains in SCOPe 2.06: d1a2vc1, d1a2vc2, d1a2vc3
  • Chain 'D':
    Compound: methylamine oxidase
    Species: Pichia angusta [TaxId:4905]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12807 (0-654)
      • modified residue (387)
    Domains in SCOPe 2.06: d1a2vd1, d1a2vd2, d1a2vd3
  • Chain 'E':
    Compound: methylamine oxidase
    Species: Pichia angusta [TaxId:4905]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12807 (0-654)
      • modified residue (387)
    Domains in SCOPe 2.06: d1a2ve1, d1a2ve2, d1a2ve3
  • Chain 'F':
    Compound: methylamine oxidase
    Species: Pichia angusta [TaxId:4905]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12807 (0-654)
      • modified residue (387)
    Domains in SCOPe 2.06: d1a2vf1, d1a2vf2, d1a2vf3
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2vA (A:)
    parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
    layyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavieq
    cvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpivd
    teekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtgn
    vmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkha
    ldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkhs
    dfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgdd
    eeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygna
    fysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakegs
    lvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilff
    htfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2vB (B:)
    parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
    layyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavieq
    cvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpivd
    teekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtgn
    vmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkha
    ldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkhs
    dfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgdd
    eeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygna
    fysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakegs
    lvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilff
    htfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2vC (C:)
    parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
    layyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavieq
    cvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpivd
    teekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtgn
    vmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkha
    ldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkhs
    dfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgdd
    eeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygna
    fysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakegs
    lvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilff
    htfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2vD (D:)
    parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
    layyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavieq
    cvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpivd
    teekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtgn
    vmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkha
    ldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkhs
    dfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgdd
    eeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygna
    fysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakegs
    lvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilff
    htfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2vE (E:)
    parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
    layyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavieq
    cvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpivd
    teekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtgn
    vmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkha
    ldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkhs
    dfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgdd
    eeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygna
    fysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakegs
    lvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilff
    htfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2vF (F:)
    parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
    layyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavieq
    cvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpivd
    teekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtgn
    vmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkha
    ldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkhs
    dfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgdd
    eeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygna
    fysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakegs
    lvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilff
    htfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav