PDB entry 1a2v

View 1a2v on RCSB PDB site
Description:
Deposited on 1998-01-12, released 1998-05-27
The last revision prior to the SCOP 1.55 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.184
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2vA (A:)
    parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
    layyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavieq
    cvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpivd
    teekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtgn
    vmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkha
    ldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkhs
    dfrdnfatslvtratklvvsqiftaanaeyclywvfmqdgairldirltgilntyilgdd
    eeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygna
    fysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakegs
    lvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilff
    htfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2vB (B:)
    parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
    layyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavieq
    cvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpivd
    teekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtgn
    vmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkha
    ldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkhs
    dfrdnfatslvtratklvvsqiftaanaeyclywvfmqdgairldirltgilntyilgdd
    eeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygna
    fysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakegs
    lvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilff
    htfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2vC (C:)
    parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
    layyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavieq
    cvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpivd
    teekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtgn
    vmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkha
    ldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkhs
    dfrdnfatslvtratklvvsqiftaanaeyclywvfmqdgairldirltgilntyilgdd
    eeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygna
    fysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakegs
    lvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilff
    htfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2vD (D:)
    parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
    layyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavieq
    cvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpivd
    teekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtgn
    vmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkha
    ldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkhs
    dfrdnfatslvtratklvvsqiftaanaeyclywvfmqdgairldirltgilntyilgdd
    eeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygna
    fysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakegs
    lvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilff
    htfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2vE (E:)
    parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
    layyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavieq
    cvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpivd
    teekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtgn
    vmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkha
    ldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkhs
    dfrdnfatslvtratklvvsqiftaanaeyclywvfmqdgairldirltgilntyilgdd
    eeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygna
    fysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakegs
    lvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilff
    htfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2vF (F:)
    parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
    layyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavieq
    cvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpivd
    teekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtgn
    vmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkha
    ldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkhs
    dfrdnfatslvtratklvvsqiftaanaeyclywvfmqdgairldirltgilntyilgdd
    eeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygna
    fysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakegs
    lvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilff
    htfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav