PDB entry 1a2u

View 1a2u on RCSB PDB site
Description: staphylococcal nuclease, v23c variant, complex with 1-n-butane thiol and 3',5'-thymidine diphosphate
Class: nuclease
Keywords: nuclease, unnatural amino acid, hydrolase, endonuclease
Deposited on 1998-01-11, released 1998-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.174
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal nuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered, modified (22)
    Domains in SCOPe 2.07: d1a2ua_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a2uA (A:)
    atstkklhkepatlikaidgdtcklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
    heqhlrkseaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a2uA (A:)
    lhkepatlikaidgdtcklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
    kseaqakkeklniws