PDB entry 1a2p

View 1a2p on RCSB PDB site
Description: barnase wildtype structure at 1.5 angstroms resolution
Deposited on 1998-01-07, released 1998-04-29
The last revision prior to the SCOP 1.55 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.115
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1a2pa_
  • Chain 'B':
    Domains in SCOP 1.55: d1a2pb_
  • Chain 'C':
    Domains in SCOP 1.55: d1a2pc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2pA (A:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2pB (B:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2pC (C:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir