PDB entry 1a2o

View 1a2o on RCSB PDB site
Description: structural basis for methylesterase cheb regulation by a phosphorylation-activated domain
Class: bacterial chemotaxis
Keywords: bacterial chemotaxis, adaptation, serine hydrolase
Deposited on 1998-01-06, released 1998-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.225
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cheb methylesterase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a2oa1, d1a2oa2
  • Chain 'B':
    Compound: cheb methylesterase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a2ob1, d1a2ob2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a2oA (A:)
    mskirvlsvddsalmrqimteiinshsdmemvatapdplvardlikkfnpdvltldvemp
    rmdgldfleklmrlrpmpvvmvssltgkgsevtlralelgaidfvtkpqlgiregmlays
    emiaekvrtaarariaahkpmaapttlkagpllssekliaigastggteairhvlqplpl
    sspaviitqhmppgftrsfaerlnklcqisvkeaedgervlpghayiapgdkhmelarsg
    anyqikihdgppvnrhrpsvdvlfhsvakhagrnavgviltgmgndgaagmlamyqagaw
    tiaqneascvvfgmpreainmggvsevvdlsqvsqqmlakisagqairi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a2oA (A:)
    mskirvlsvddsalmrqimteiinshsdmemvatapdplvardlikkfnpdvltldvemp
    rmdgldfleklmrlrpmpvvmvssltgkgsevtlralelgaidfvtkpqlgiregmlays
    emiaekvrtaarariaahkpmaapttlkagpllssekliaigastggteairhvlqplpl
    sspaviitqhmppgftrsfaerlnklcqisvkeaedgervlpghayiapgdkhmelarsg
    anyqikihdgppvnrhrpsvdvlfhsvakhagrnavgviltgmgndgaagmlamyqagaw
    tiaqneascvvfgmpreainmggvsevvdlsqvsqqmlakisagqai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a2oB (B:)
    mskirvlsvddsalmrqimteiinshsdmemvatapdplvardlikkfnpdvltldvemp
    rmdgldfleklmrlrpmpvvmvssltgkgsevtlralelgaidfvtkpqlgiregmlays
    emiaekvrtaarariaahkpmaapttlkagpllssekliaigastggteairhvlqplpl
    sspaviitqhmppgftrsfaerlnklcqisvkeaedgervlpghayiapgdkhmelarsg
    anyqikihdgppvnrhrpsvdvlfhsvakhagrnavgviltgmgndgaagmlamyqagaw
    tiaqneascvvfgmpreainmggvsevvdlsqvsqqmlakisagqairi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a2oB (B:)
    mskirvlsvddsalmrqimteiinshsdmemvatapdplvardlikkfnpdvltldvemp
    rmdgldfleklmrlrpmpvvmvssltgkgsevtlralelgaidfvtkpqlgiregmlays
    emiaekvrtaarariaahkpmaapttlkagpllssekliaigastggteairhvlqplpl
    sspaviitqhmppgftrsfaerlnklcqisvkeaedgervlpghayiapgdkhmelarsg
    anyqikihdgppvnrhrpsvdvlfhsvakhagrnavgviltgmgndgaagmlamyqagaw
    tiaqneascvvfgmpreainmggvsevvdlsqvsqqmlakisagqai