PDB entry 1a2n

View 1a2n on RCSB PDB site
Description: structure of the c115a mutant of mura complexed with the fluorinated analog of the reaction tetrahedral intermediate
Class: transferase
Keywords: transferase, peptidoglycan synthesis, enolpyruvyl transferase, udp-n-acetylglucosamine
Deposited on 1998-01-06, released 1998-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.175
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylglucosamine enolpyruvyl transferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A749 (0-End)
      • engineered (114)
    Domains in SCOPe 2.07: d1a2na_
  • Heterogens: TET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a2nA (A:)
    mdkfrvqgptklqgevtisgaknaalpilfaallaeepveiqnvpklkdvdtsmkllsql
    gakverngsvhidardvnvfcapydlvktmrasiwalgplvarfgqgqvslpggatigar
    pvdlhisgleqlgatikleegyvkasvdgrlkgahivmdkvsvgatvtimcaatlaegtt
    iienaarepeivdtanflitlgakisgqgtdriviegverlgggvyrvlpdrietgtflv
    aaaisrgkiicrnaqpdtldavlaklrdagadievgedwisldmhgkrpkavnvrtaphp
    afptdmqaqftllnlvaegtgfitetvfenrfmhvpelsrmgahaeiesntvichgvekl
    sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a2nA (A:)
    mdkfrvqgptklqgevtisgaknaalpilfaallaeepveiqnvpklkdvdtsmkllsql
    gakverngsvhidardvnvfcapydlvktmrasiwalgplvarfgqgqvslpggatigar
    pvdlhisgleqlgatikleegyvkasvdgrlkgahivmdkvsvgatvtimcaatlaegtt
    iienaarepeivdtanflitlgakisgqgtdriviegverlgggvyrvlpdrietgtflv
    aaaisrgkiicrnaqpdtldavlaklrdagadievgedwisldmhgkrpkavnvrtaphp
    afptdmqaqftllnlvaegtgfitetvfenrfmhvpelsrmgahaeiesntvichgvekl
    sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkg