PDB entry 1a2i

View 1a2i on RCSB PDB site
Description: solution structure of desulfovibrio vulgaris (hildenborough) ferrocytochrome c3, nmr, 20 structures
Class: electron transport
Keywords: electron transport, hemeprotein, electron transfer, redox-bohr effect, cooperativity, energy transduction
Deposited on 1998-01-05, released 1998-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c3
  Species: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough [TaxId:882]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00131 (0-106)
  Domains in SCOPe 2.07: d1a2ia_
• Heterogens: HEC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a2iA (A:)
  apkapadglkmeatkqpvvfnhsthksvkcgdchhpvngkedyrkcgtagchdsmdkkdk
  sakgyyhvmhdkntkfkscvgchvevagadaakkkdltgckkskche