PDB entry 1a2i

View 1a2i on RCSB PDB site
Description: solution structure of desulfovibrio vulgaris (hildenborough) ferrocytochrome c3, nmr, 20 structures
Deposited on 1998-01-05, released 1998-07-08
The last revision prior to the SCOP 1.55 freeze date was dated 1998-07-08, with a file datestamp of 1998-07-08.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1a2i__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a2i_ (-)
  apkapadglkmeatkqpvvfnhsthksvkcgdchhpvngkedyrkcgtagchdsmdkkdk
  sakgyyhvmhdkntkfkscvgchvevagadaakkkdltgckkskche