PDB entry 1a2i

View 1a2i on RCSB PDB site
Description: solution structure of desulfovibrio vulgaris (hildenborough) ferrocytochrome c3, nmr, 20 structures
Class: electron transport
Keywords: electron transport, hemeprotein, electron transfer, redox-bohr effect, cooperativity, energy transduction
Deposited on 1998-01-05, released 1998-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough [TaxId:882]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a2ia_
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2iA (A:)
    apkapadglkmeatkqpvvfnhsthksvkcgdchhpvngkedyrkcgtagchdsmdkkdk
    sakgyyhvmhdkntkfkscvgchvevagadaakkkdltgckkskche