PDB entry 1a2b

View 1a2b on RCSB PDB site
Description: human rhoa complexed with GTP analogue
Class: oncogene protein
Keywords: small g-protein, signal transduction, gtpase, ras superfamily, oncogene protein
Deposited on 1997-12-26, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.195
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61586 (Start-181)
      • engineered (14)
    Domains in SCOPe 2.07: d1a2ba_
  • Heterogens: MG, GSP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a2bA (A:)
    smaairkklvivgdvacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwd
    tagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkk
    dlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraal
    qa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a2bA (A:)
    irkklvivgdvacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtagq
    edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn
    dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa