PDB entry 1a2a

View 1a2a on RCSB PDB site
Description: agkistrotoxin, a phospholipase a2-type presynaptic neurotoxin from agkistrodon halys pallas
Class: presynaptic neurotoxin
Keywords: presynaptic neurotoxin, phospholipase a2, hydrolase, lipid degradation
Deposited on 1997-12-25, released 1999-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.207
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14421 (0-121)
      • conflict (32)
    Domains in SCOPe 2.08: d1a2aa_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14421 (0-121)
      • conflict (32)
    Domains in SCOPe 2.08: d1a2ab_
  • Chain 'C':
    Compound: phospholipase a2
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14421 (0-121)
      • conflict (32)
    Domains in SCOPe 2.08: d1a2ac_
  • Chain 'D':
    Compound: phospholipase a2
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14421 (0-121)
      • conflict (32)
    Domains in SCOPe 2.08: d1a2ad_
  • Chain 'E':
    Compound: phospholipase a2
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14421 (0-121)
      • conflict (32)
    Domains in SCOPe 2.08: d1a2ae_
  • Chain 'F':
    Compound: phospholipase a2
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14421 (0-121)
      • conflict (32)
    Domains in SCOPe 2.08: d1a2af_
  • Chain 'G':
    Compound: phospholipase a2
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14421 (0-121)
      • conflict (32)
    Domains in SCOPe 2.08: d1a2ag_
  • Chain 'H':
    Compound: phospholipase a2
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14421 (0-121)
      • conflict (32)
    Domains in SCOPe 2.08: d1a2ah_
  • Heterogens: CL

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2aA (A:)
    nllqfnkmikeetgknaipfyafygcycggggngkpkdgtdrccfvhdccygrlvncntk
    sdiysyslkegyitcgkgtnceeqicecdrvaaecfrrnldtynngymfyrdskctetse
    ec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2aB (B:)
    nllqfnkmikeetgknaipfyafygcycggggngkpkdgtdrccfvhdccygrlvncntk
    sdiysyslkegyitcgkgtnceeqicecdrvaaecfrrnldtynngymfyrdskctetse
    ec
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2aC (C:)
    nllqfnkmikeetgknaipfyafygcycggggngkpkdgtdrccfvhdccygrlvncntk
    sdiysyslkegyitcgkgtnceeqicecdrvaaecfrrnldtynngymfyrdskctetse
    ec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2aD (D:)
    nllqfnkmikeetgknaipfyafygcycggggngkpkdgtdrccfvhdccygrlvncntk
    sdiysyslkegyitcgkgtnceeqicecdrvaaecfrrnldtynngymfyrdskctetse
    ec
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2aE (E:)
    nllqfnkmikeetgknaipfyafygcycggggngkpkdgtdrccfvhdccygrlvncntk
    sdiysyslkegyitcgkgtnceeqicecdrvaaecfrrnldtynngymfyrdskctetse
    ec
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2aF (F:)
    nllqfnkmikeetgknaipfyafygcycggggngkpkdgtdrccfvhdccygrlvncntk
    sdiysyslkegyitcgkgtnceeqicecdrvaaecfrrnldtynngymfyrdskctetse
    ec
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2aG (G:)
    nllqfnkmikeetgknaipfyafygcycggggngkpkdgtdrccfvhdccygrlvncntk
    sdiysyslkegyitcgkgtnceeqicecdrvaaecfrrnldtynngymfyrdskctetse
    ec
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2aH (H:)
    nllqfnkmikeetgknaipfyafygcycggggngkpkdgtdrccfvhdccygrlvncntk
    sdiysyslkegyitcgkgtnceeqicecdrvaaecfrrnldtynngymfyrdskctetse
    ec